PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G161800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 517aa    MW: 56679.7 Da    PI: 7.8529
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G161800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.23.7e-1475114141
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         k+kk+CnCk+s+Clk+YCeCfaag +C+  C+C++C N+ e
  Seita.4G161800.1.p  75 KKKKHCNCKNSQCLKLYCECFAAGDYCDG-CNCKQCGNTVE 114
                         589**************************.********987 PP

2TCR50.34.8e-16159197139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC dCkN 
  Seita.4G161800.1.p 159 KHNKGCHCKKSGCLKKYCECFQANILCSKNCKCMDCKNF 197
                         589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.8E-1475115IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.11376199IPR005172CRC domain
PfamPF036385.7E-1177112IPR005172CRC domain
SMARTSM011141.7E-18159200IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12162197IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MEQEKQQRVE PPAPAPAPTP APQASSEPRA PPHPQQQPKP AIPVQPSLPV TRPWPMSIIP  60
SVKPAVEVKS GTPAKKKKHC NCKNSQCLKL YCECFAAGDY CDGCNCKQCG NTVENDKVRQ  120
EAINNTILRN PNAFQPKIEN SPITPSVRKD AGAPPSLPKH NKGCHCKKSG CLKKYCECFQ  180
ANILCSKNCK CMDCKNFDGS EELRAIIQGD NSCDRNNIQQ AANVALNGAI GSSGYRFSPV  240
RRKRPPEDPH YQRLNVEGNM MQMQFQEVSH LDASQIASST GLEGSTGNFH SKSKLVYRSP  300
LANTIHPSDV NDLANRLVIV CRKAAEGFTT IADNKVEMEI DREVFINTDQ NFDENKKEFQ  360
KAAASQLGDV TKIDQQIPGD SGSYCSNTQE DSRPASPGTR ALLCDEQDLT FGTAYRSSIP  420
VALHDQDISE LQTAQENVVL REFRNYLRLI IARGKLNEGK SSSGTVMELD ATRNHESSTT  480
LPPVRAEEKS CAPDDPRNPK TSKSFGSDGV STHEIK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965468.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLC5Z3600.0C5Z360_SORBI; Putative uncharacterized protein Sb10g019660
STRINGSb10g019660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57552653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.12e-92Tesmin/TSO1-like CXC domain-containing protein